Helicobacter pylori HUP-B14: HPB14_03890 Help Entry HPB14_03890       CDS       T02035                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hcn  Helicobacter pylori HUP-B14 Pathway hcn01100   Metabolic pathways hcn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hcn00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPB14_03890 (acpP)    00074 Mycolic acid biosynthesis     HPB14_03890 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPB14_03890 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 Ribosomal_L12_N PP-binding_2 DUF1493 DUF2624 Motif Other DBs NCBI-ProteinID:  AFI07477 UniProt:  A0AB32ZQQ4 LinkDB All DBs Position 801831..802067 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDATQVTPEAEFVKDLGADSLDVVELIMALEEKFNIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcgacg caagttaccccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattgatcatggcgttagaagaaaagtttaacattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggacaataaactagcttaa

DBGET integrated database retrieval system