Hippocampus comes (tiger tail seahorse): 109508383 Help Entry 109508383         CDS       T04969                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq04060   Cytokine-cytokine receptor interaction hcq04218   Cellular senescence hcq04620   Toll-like receptor signaling pathway hcq04621   NOD-like receptor signaling pathway hcq04622   RIG-I-like receptor signaling pathway hcq05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hcq00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     109508383  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     109508383  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109508383    04621 NOD-like receptor signaling pathway     109508383    04622 RIG-I-like receptor signaling pathway     109508383  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109508383  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hcq04052]     109508383    00536 Glycosaminoglycan binding proteins [BR:hcq00536]     109508383 Cytokines and neuropeptides [BR:hcq04052]  Cytokines   Chemokines    109508383 Glycosaminoglycan binding proteins [BR:hcq00536]  Heparan sulfate / Heparin   Chemokines    109508383 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  109508383 NCBI-ProteinID:  XP_019713889 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MELRALLAFGSLLAVCGGLPPISRDYNTRCGCLRMETRIIPPDSLRSIKLVPEGPHCTQT EIIATLVSGERVCLHPQSWWVKKLVHFVLEKQLHRRAAVISRRPA NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atggagctccgcgccctgctcgcctttgggagcctgctggccgtctgcggcggcctgccg cccatcagccgcgactacaacacacgctgcggctgcctgcggatggagaccaggatcatc ccgccggacagtttgcgcagcatcaagttggtccccgaggggccgcactgcacgcagacc gagatcatagccaccctggtgagcggcgagcgcgtctgcctgcaccctcagtcgtggtgg gtgaagaagctggttcacttcgtcctcgagaagcagctccatcggcgggccgccgtgatt tcccggaggccggcgtga

DBGET integrated database retrieval system