Hippocampus comes (tiger tail seahorse): 109508662 Help Entry 109508662         CDS       T04969                                  Name (RefSeq) histone H2AX-like   KO K11251   histone H2A Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq03082   ATP-dependent chromatin remodeling hcq04217   Necroptosis Brite KEGG Orthology (KO) [BR:hcq00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     109508662  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     109508662  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hcq03036]     109508662   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hcq04147]     109508662 Chromosome and associated proteins [BR:hcq03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109508662 Exosome [BR:hcq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109508662 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF ParE_like Motif Other DBs NCBI-GeneID:  109508662 NCBI-ProteinID:  XP_019714238 LinkDB All DBs Position Unknown AA seq 130 aa AA seqDB search MSGRGKGASKARAKARTRSNRAGLQFPVGRVHRLLRRGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKK TGQSAPSSGK NT seq 391 nt NT seq  +upstreamnt  +downstreamnt atgtctggaagaggcaaaggcgccagcaaggcccgcgcgaaagctaggacccgtagcaac cgggcaggtctccagttcccggtcggtcgagtccaccgtcttctccgcagaggcaactac gcagagcgtgttggtgccggtgctccagtctacttggccgccgtgctggaatatctcacc gccgagatcctcgagttggctggtaacgccgcccgggacaacaagaagactcgcatcatt cctcgccaccttcagttggcggtacgcaacgacgaagagctgaataaacttcttggcggc gtcaccatcgcccagggcggtgtcctgcccaacatccaggccgtcctgctgcctaagaag actggacagtctgctccgagctccggcaagg

DBGET integrated database retrieval system