Hippocampus comes (tiger tail seahorse): 109509423 Help Entry 109509423         CDS       T04969                                  Name (RefSeq) histone H2B 1/2-like   KO K11252   histone H2B Organism hcq  Hippocampus comes (tiger tail seahorse) Brite KEGG Orthology (KO) [BR:hcq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hcq03036]     109509423   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hcq04147]     109509423 Chromosome and associated proteins [BR:hcq03036]  Eukaryotic type   Nucleosome assembly factors    Histones     109509423 Exosome [BR:hcq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109509423 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa Motif Other DBs NCBI-GeneID:  109509423 NCBI-ProteinID:  XP_019714831 LinkDB All DBs Position Unknown AA seq 91 aa AA seqDB search MPEPQKPAAKKGSKKAVTKSTNKAGRKKKKTRKQSYAIYVYKVLKQVHPDTGISSKAMSI MNSFVNDIFERIASEASRLAHYNKRSTITSR NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcctgaaccacagaagcccgccgccaagaaaggttccaagaaagccgtcacaaagtca accaacaaggccggcaggaagaagaagaagaccaggaagcaatcctacgccatttatgtc tacaaggtactaaaacaggtccacccggataccggtatctcttcgaaggccatgagcatt atgaactccttcgtcaacgatatcttcgagcgcattgcttctgaggcgtctcgtctggct cactacaacaagcgctccaccattacatccagg

DBGET integrated database retrieval system