Hippocampus comes (tiger tail seahorse): 109511164 Help Entry 109511164         CDS       T04969                                  Symbol dnal4 Name (RefSeq) dynein light chain 4, axonemal   KO K10412   dynein axonemal light chain 4 Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq04814   Motor proteins Brite KEGG Orthology (KO) [BR:hcq00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     109511164 (dnal4)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hcq03037]     109511164 (dnal4)    04812 Cytoskeleton proteins [BR:hcq04812]     109511164 (dnal4) Cilium and associated proteins [BR:hcq03037]  Motile cilia and associated proteins   Dynein arm    109511164 (dnal4) Cytoskeleton proteins [BR:hcq04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      109511164 (dnal4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Ground-like Motif Other DBs NCBI-GeneID:  109511164 NCBI-ProteinID:  XP_019717558 UniProt:  A0A3Q2XE21 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MAGTGEGKKEEADYKRLHSFPLIRHTDMPEEMRVETMELCVTACEKFATNNESAAKMIKE SMDKKFGSSWHVVIGEGFGFEVTHEVKNLLYMFFGGSLAVCVWKCS NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atggcaggaaccggcgagggaaagaaagaagaggccgactacaagagactacacagcttc cctctcatcaggcacacggacatgcccgaagaaatgagggtggagacgatggagctgtgc gtgaccgcctgtgaaaagtttgccaccaacaatgagagtgccgccaagatgatcaaggag tccatggacaagaaattcggcagttcttggcacgtggtgatcggcgagggcttcggcttc gaggtcacgcacgaggtgaaaaacttgctctacatgttcttcggcgggagtctggccgtg tgtgtgtggaagtgctcctag

DBGET integrated database retrieval system