Hippocampus comes (tiger tail seahorse): 109511304 Help Entry 109511304         CDS       T04969                                  Symbol ubl5 Name (RefSeq) ubiquitin-like protein 5   KO K13113   ubiquitin-like protein 5 Organism hcq  Hippocampus comes (tiger tail seahorse) Brite KEGG Orthology (KO) [BR:hcq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:hcq03041]     109511304 (ubl5)   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:hcq04052]     109511304 (ubl5) Spliceosome [BR:hcq03041]  Complex B   Other components    Complex B specific factors     109511304 (ubl5) Cytokines and neuropeptides [BR:hcq04052]  Neuropeptides   Unclassified    109511304 (ubl5) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Crinkler Motif Other DBs NCBI-GeneID:  109511304 NCBI-ProteinID:  XP_019717857 UniProt:  A0A3Q2XVQ2 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKVRVKCNSEDTIGDLKKLIAAQTGTRYDKIVLKKWYTIFKDHVSLGDY EIHDGMNLELYYQ NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtgtgcaacgatcgtctgggcaagaaagtccgcgtaaagtgcaactcc gaggacaccatcggagacctaaagaagctcatcgcagcgcagacggggacgcggtatgac aaaatagtcttgaagaaatggtacaccatattcaaggaccatgtgtcactgggagattat gagatccacgacggcatgaacctggaattgtactaccagtga

DBGET integrated database retrieval system