Hippocampus comes (tiger tail seahorse): 109519324 Help Entry 109519324         CDS       T04969                                  Symbol bax Name (RefSeq) apoptosis regulator BAX   KO K02159   apoptosis regulator BAX Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq04115   p53 signaling pathway hcq04141   Protein processing in endoplasmic reticulum hcq04210   Apoptosis hcq04217   Necroptosis hcq05132   Salmonella infection hcq05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:hcq00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109519324 (bax)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     109519324 (bax)    04217 Necroptosis     109519324 (bax)    04115 p53 signaling pathway     109519324 (bax)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     109519324 (bax)   09171 Infectious disease: bacterial    05132 Salmonella infection     109519324 (bax)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hcq03029]     109519324 (bax)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:hcq02000]     109519324 (bax) Mitochondrial biogenesis [BR:hcq03029]  Mitochondrial quality control factors   Mitochondrial dynamics    Fission and Fusion factors     109519324 (bax) Transporters [BR:hcq02000]  Other transporters   Pores ion channels [TC:1]    109519324 (bax) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 Amphi-Trp Motif Other DBs NCBI-GeneID:  109519324 NCBI-ProteinID:  XP_019731333 LinkDB All DBs Position Unknown AA seq 192 aa AA seqDB search MAAHPGGGGQGDSKEQILELGAVLLKDFIYERVRRHGDNSAVVTRAQLGGGEICDTSHKR LAQCLQKIGDELDGNVELQQMINSPSLRPTKEVFVKVAVEIFADGKFSWGRVVTLFYLAC RLVIKALLTQVPDVIRTIINWTIDYLREHFLNWIWEQGGWESIRSYFGTPTWQLVAVFMA GVIATIIVTRKM NT seq 579 nt NT seq  +upstreamnt  +downstreamnt atggcagcgcacccgggtggaggaggacaaggcgactccaaggagcagatactggaactg ggggctgtcttgttaaaagatttcatttacgagcgagtccgccggcacggagacaacagc gccgtcgtgacccgggcccagctgggtggaggcgagatatgcgataccagccacaagagg ctggcccagtgcctacagaagattggagacgagctggacggcaatgtggaactccaacag atgatcaactccccctcgctgagacccaccaaggaggtgtttgtgaaagtggctgttgag atcttcgccgacggaaagttcagctggggccgagttgtcactctcttttacttggcctgt cgactagtcatcaaagcgctcttgactcaagttcccgacgtcatcagaaccatcatcaac tggaccatcgactacctccgtgaacactttctcaactggatctgggagcaaggaggctgg gagagcattcgctcttactttggcactccgacgtggcaactggtggctgtgttcatggca ggggtcatcgccacgataatcgtgactcgtaaaatgtga

DBGET integrated database retrieval system