Hippocampus comes (tiger tail seahorse): 109521092 Help Entry 109521092         CDS       T04969                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq04382   Cornified envelope formation hcq05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hcq00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109521092  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109521092  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hcq04147]     109521092 Exosome [BR:hcq04147]  Exosomal proteins   Exosomal proteins of microglial cells    109521092 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_8 EF-hand_5 Motif Other DBs NCBI-GeneID:  109521092 NCBI-ProteinID:  XP_019734283 UniProt:  A0A3Q3DUS7 LinkDB All DBs Position Unknown AA seq 98 aa AA seqDB search MSDLEKCMENLIVIFHRYAKDDGDGRTLSKKELKKLLEVELPTFLKTQKNPKTVDCILQD LDLNKDDKLDFEEFLPLVAGLSLACEKCYVLHQKKGKQ NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgagtgacttggagaaatgcatggagaacctcattgtcattttccaccgctacgccaaa gacgacggcgatggcaggacgctaagcaaaaaagaactgaaaaaactattggaggtagag ctacccaccttcctcaagactcaaaagaaccccaaaacagtggattgcatcttgcaggac ctggacctgaacaaagacgacaagttagactttgaagagtttctccccctggtcgcgggc ctctccttggcgtgtgagaagtgctacgtgcttcaccaaaagaagggcaaacaataa

DBGET integrated database retrieval system