Hippocampus comes (tiger tail seahorse): 109522217 Help Entry 109522217         CDS       T04969                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq04137   Mitophagy - animal hcq04140   Autophagy - animal hcq04144   Endocytosis hcq04145   Phagosome hcq04148   Efferocytosis hcq05132   Salmonella infection Brite KEGG Orthology (KO) [BR:hcq00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     109522217    04145 Phagosome     109522217    04140 Autophagy - animal     109522217    04137 Mitophagy - animal     109522217    04148 Efferocytosis     109522217  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     109522217  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:hcq04131]     109522217   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hcq04147]     109522217    04031 GTP-binding proteins [BR:hcq04031]     109522217 Membrane trafficking [BR:hcq04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     109522217 Exosome [BR:hcq04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109522217   Exosomal proteins of other body fluids (saliva and urine)    109522217   Exosomal proteins of colorectal cancer cells    109522217   Exosomal proteins of bladder cancer cells    109522217 GTP-binding proteins [BR:hcq04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     109522217 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  109522217 NCBI-ProteinID:  XP_019736121 UniProt:  A0A3Q2ZHM9 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttcacggaagaaagtcctcctcaaagtcattatcctcggggactccggagtcggg aagacctcgttgatgaaccagtacgtgaataagaagttcagcaaccagtacaaggccacg ataggtgcagatttcttgacgaaagaagtcatggtggatgacagactggtcacaatgcag atttgggacacagcaggtcaggagaggttccagtctttaggcgtggcgttttaccgcgga gcggactgctgcgttctggtgttcgacgtgacggcccccaacactttcaagaccctcgac agctggagggacgagttcctgatccaagccagcccccgagacccggagaatttccccttt gtggtgctcggcaacaagatcgacttggagaacagacaggtcacgaccaagcgggcgcaa gcttggtgtcagagcaagaacaacatcccttattttgaaaccagcgccaaggaggccatc aatgtggagcaggccttccagaccattgcgcgcaacgctctcaaacaggagaccgaagtg gagttgtacaacgagttcccggagcccattaagctggacaggaatgagcgagccaagcct tcggcggagacctgcagctgctga

DBGET integrated database retrieval system