Hippocampus comes (tiger tail seahorse): 109522461 Help Entry 109522461         CDS       T04969                                  Name (RefSeq) GTP-binding protein Rheb-like   KO K07208   Ras homolog enriched in brain Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq04140   Autophagy - animal hcq04150   mTOR signaling pathway hcq04218   Cellular senescence hcq04910   Insulin signaling pathway hcq05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:hcq00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     109522461  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109522461   09143 Cell growth and death    04218 Cellular senescence     109522461  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     109522461  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     109522461  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:hcq04031]     109522461 GTP-binding proteins [BR:hcq04031]  Small (monomeric) G-proteins   Ras Family    Rheb     109522461 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase AAA_14 RhoGAP_pG1_pG2 Motif Other DBs NCBI-GeneID:  109522461 NCBI-ProteinID:  XP_019736613 UniProt:  A0A3Q2XFL3 LinkDB All DBs Position Unknown AA seq 184 aa AA seqDB search MPQPKYRKIAVIGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFNKMVSVNCQDFHLQLVD TAGQDEYSIFPHSHSMDIHGYVLVYSVTSMKSFEVVQVLHDKLLDMVGKIQVPTVLVGNK KDLHMERVIKPEEGKKLADSWGAAFMESSAKENETAVEVFKRIILEMEKADGNAPPEEKK CAMM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgcagccgaagtaccggaagattgctgtgatcggttacagatctgttggaaagtca tctctcacaatacagtttgtggaaggacagtttgtcgactcctatgacccaacaattgaa aacaccttcaataaaatggtcagcgtgaattgtcaagacttccatcttcagctggttgac acagctggacaagatgaatactccattttcccccactcccactcaatggacatccacggc tatgtccttgtttattctgtgacatccatgaaaagttttgaggtcgttcaggttctacac gacaagctgctggatatggttggaaaaattcaagttccaactgtgcttgttggaaacaaa aaagatctccacatggaaagggtcataaagccagaggagggaaagaagcttgctgattcc tggggtgctgctttcatggagtcttcagccaaggagaatgagaccgccgtggaggttttc aagcgaatcatattggagatggagaaagccgacgggaatgccccgccggaggagaagaaa tgtgccatgatgtaa

DBGET integrated database retrieval system