Hippocampus comes (tiger tail seahorse): 109525889 Help Entry 109525889         CDS       T04969                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq04010   MAPK signaling pathway hcq04137   Mitophagy - animal hcq04140   Autophagy - animal hcq04218   Cellular senescence hcq04371   Apelin signaling pathway hcq04625   C-type lectin receptor signaling pathway hcq04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:hcq00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109525889 (rras2)    04371 Apelin signaling pathway     109525889 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     109525889 (rras2)    04137 Mitophagy - animal     109525889 (rras2)   09143 Cell growth and death    04218 Cellular senescence     109525889 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     109525889 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109525889 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hcq04147]     109525889 (rras2)    04031 GTP-binding proteins [BR:hcq04031]     109525889 (rras2) Exosome [BR:hcq04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109525889 (rras2)   Exosomal proteins of bladder cancer cells    109525889 (rras2) GTP-binding proteins [BR:hcq04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     109525889 (rras2) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 ATP_bind_1 SLFN-g3_helicase FeoB_N Motif Other DBs NCBI-GeneID:  109525889 NCBI-ProteinID:  XP_019742312 UniProt:  A0A3Q2XA95 LinkDB All DBs Position Unknown AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERAA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRKEKDKSGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggcaggctggaaggacggctcggtgcaggagaagtaccggctggtcgtggtcggaggc ggcggggtgggcaagtcggccctgacgatccagtttattcagtcctactttgtcacggac tatgaccccacaattgaggactcttataccaagcagtgtgtgattgacgaaagggcagcc aggctggacattctagacacggctgggcaggaagagtttggagccatgagagaacaatac atgaggacaggggagggcttcctgctcgtcttctcagtcaccgacagaggaagcttcgaa gaaatctacaaattccaaagacaaattctgcgagtgaaagacagagatgaattcccgatg atcctcgtagggaacaaagccgatctggagctgcagagacaagtaactcaagaggagggc cagcagctggccagacagttgaaggtcacttacatggaggcttcagccaaaatccgtatg aatgtcgaccaggcttttcacgagctggttcgagtaattaggaagttccaagaacaggaa tgtccaccgtcgccagaaccgacaagaaaagagaaagacaagagcggctgccattgtgtg atcgtctga

DBGET integrated database retrieval system