Hippocampus comes (tiger tail seahorse): 109526689 Help Entry 109526689         CDS       T04969                                  Symbol ppp3r1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq04010   MAPK signaling pathway hcq04020   Calcium signaling pathway hcq04114   Oocyte meiosis hcq04218   Cellular senescence hcq04310   Wnt signaling pathway hcq04370   VEGF signaling pathway hcq04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:hcq00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     109526689 (ppp3r1)    04310 Wnt signaling pathway     109526689 (ppp3r1)    04370 VEGF signaling pathway     109526689 (ppp3r1)    04020 Calcium signaling pathway     109526689 (ppp3r1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     109526689 (ppp3r1)    04218 Cellular senescence     109526689 (ppp3r1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     109526689 (ppp3r1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:hcq01009]     109526689 (ppp3r1) Protein phosphatases and associated proteins [BR:hcq01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109526689 (ppp3r1) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 EH SPARC_Ca_bdg EF-hand_9 RSA-1_C Motif Other DBs NCBI-GeneID:  109526689 NCBI-ProteinID:  XP_019743689 UniProt:  A0A3Q3DGR1 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MGNEASYPLEMCTHFDPDEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVID IFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMV GNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgggaaatgaagccagctaccctctggaaatgtgcacacattttgacccggacgagatc aagcgtctggggaagcgcttcaagaagctggaccttgacaactcggggtcgctcagcgtg gaggagttcatgtcgctgcctgagttacagcagaaccctctcgtgcagagggtcatcgac atattcgacacggacggcaacggagaagtggactttaaagagttcattgaaggagtgtca cagttcagcgtcaaaggcgacaaggagcagaagcttcgattcgcattccggatctacgac atggacaaggatggctacatctccaacggcgaactgttccaggtgctcaagatgatggtg ggcaacaacctgaaagacacacagctgcagcagattgtggacaaaaccatcatcaacgcc gacaaggacggtgatggcaggatatctttcgaggagttctgcgcggtggtgggcggcctg gacatacacaaaaagatggtggtggacgtgtga

DBGET integrated database retrieval system