Hippocampus comes (tiger tail seahorse): 109531828 Help Entry 109531828         CDS       T04969                                  Name (RefSeq) FK506-binding protein 1-like   KO K09568   FK506-binding protein 1 [EC:5.2.1.8] Organism hcq  Hippocampus comes (tiger tail seahorse) Brite KEGG Orthology (KO) [BR:hcq00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hcq03110]     109531828 Enzymes [BR:hcq01000]  5. Isomerases   5.2  cis-trans-Isomerases    5.2.1  cis-trans Isomerases (only sub-subclass identified to date)     5.2.1.8  peptidylprolyl isomerase      109531828 Chaperones and folding catalysts [BR:hcq03110]  Protein folding catalysts   Peptidyl prolyl isomerase    FKBP     109531828 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FKBP_C Motif Other DBs NCBI-GeneID:  109531828 NCBI-ProteinID:  XP_019751890 UniProt:  A0A3Q2XWN3 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MGVTVHVIKPGDGVNFPKKGQNVTVHYVGTLPNGEKFDSSRDRGKPFNFKLGHGQVIRGW DEGVAQMSKGQVARLTCTPDYAYGSRGFPPVIPPNATLLFDVELIDF NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggtgttaccgttcacgtcatcaagccaggagacggcgtcaactttccgaagaaaggc cagaacgtcaccgtgcactacgtcggcacactgccaaacggcgagaagtttgactcctcc cgggaccgaggaaagccattcaatttcaagctcggccatgggcaggtcattcgtggttgg gatgaaggtgtagctcagatgagcaaggggcaggtggcgcgcttgacctgcacaccggac tatgcgtacggcagcagggggttccctcccgtcatcccacccaacgccactctgcttttc gatgtggaactcattgacttttga

DBGET integrated database retrieval system