Hippocampus comes (tiger tail seahorse): 109532052 Help Entry 109532052         CDS       T04969                                  Name (RefSeq) claudin-6-like   KO K06087   claudin Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq03272   Virion - Hepatitis viruses hcq04382   Cornified envelope formation hcq04514   Cell adhesion molecules hcq04530   Tight junction Brite KEGG Orthology (KO) [BR:hcq00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     109532052  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecules     109532052  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     109532052  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     109532052  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:hcq03037]     109532052    04147 Exosome [BR:hcq04147]     109532052    04515 Cell adhesion molecules [BR:hcq04515]     109532052 Cilium and associated proteins [BR:hcq03037]  Other cilia and associated proteins   Stereociliary proteins    109532052 Exosome [BR:hcq04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    109532052   Exosomal proteins of colorectal cancer cells    109532052 Cell adhesion molecules [BR:hcq04515]  Immunoglobulin superfamily   L1 family    109532052 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 Clc-like Motif Other DBs NCBI-GeneID:  109532052 NCBI-ProteinID:  XP_019752212 LinkDB All DBs Position Unknown AA seq 170 aa AA seqDB search MSRAGLQLTAALLLTAGLAGAIVACALPMWKVSAFVGANIITAQTIWEGLWMSCVTQSTG HMQCKVYDSMLALPRDLQAARALVVAAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXDA QRRELGAALFVGWGSAGLLLIAGALLCCPRRRRDVSYSVKYSAAGGAAYV NT seq 513 nt NT seq  +upstreamnt  +downstreamnt atgtctcgggcgggcctgcagctgacggccgcgttgctgctgacggcgggcctggcgggc gccatcgtggcgtgcgcgctgcccatgtggaaggtgtcggcgttcgtgggcgccaacatc atcacggcgcagaccatctgggagggcctgtggatgagctgcgtgacgcagagcacgggc cacatgcagtgcaaggtgtacgactccatgctggcgctgccccgagacctgcaggcggcg cgcgccctggtggtggccgcnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnn nnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnnncgacgcg cagaggcgcgagctcggcgccgcgctcttcgtgggctggggctcggccggcctgctcctg atcgcgggggcgctgctgtgctgcccccgccgccgccgggacgtctcctactcggtcaag tactcggccgccggcggggccgcttacgtttga

DBGET integrated database retrieval system