Hippocampus comes (tiger tail seahorse): 14658018 Help Entry 14658018          CDS       T04969                                  Symbol ND4L Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism hcq  Hippocampus comes (tiger tail seahorse) Pathway hcq00190   Oxidative phosphorylation hcq01100   Metabolic pathways Module hcq_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:hcq00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     14658018 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:hcq03029]     14658018 (ND4L) Enzymes [BR:hcq01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      14658018 (ND4L) Mitochondrial biogenesis [BR:hcq03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     14658018 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  14658018 NCBI-ProteinID:  YP_007475062 UniProt:  L7Q7N1 LinkDB All DBs Position MT AA seq 98 aa AA seqDB search MTPVHFAFSTTFILGLMGLTFHRNHLLSALLCLEGMMLSLYVALSLWTLQLNSISFSPTP MLMLAFSACEASAGLALLVATSRTHGTDRLQALNILQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgacacctgtgcactttgctttctcaacaacatttattttaggacttataggattaact tttcaccgaaatcatttactctcagcccttttatgtttagaaggaatgatattatcatta tatgttgctttatccttatgaacacttcaattaaattcgattagcttctcccccacccct atactaatacttgctttttcagcatgtgaagcaagtgctgggttagccctgttagtagca acctctcgaacacacgggactgatcgccttcaagccttaaatatcttacaatgttaa

DBGET integrated database retrieval system