KEGG   Hymenobacter canadensis: O3303_05520
Entry
O3303_05520       CDS       T09156                                 
Symbol
accC
Name
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
hcw  Hymenobacter canadensis
Pathway
hcw00061  Fatty acid biosynthesis
hcw00620  Pyruvate metabolism
hcw00640  Propanoate metabolism
hcw00720  Other carbon fixation pathways
hcw01100  Metabolic pathways
hcw01110  Biosynthesis of secondary metabolites
hcw01120  Microbial metabolism in diverse environments
hcw01200  Carbon metabolism
hcw01212  Fatty acid metabolism
Module
hcw_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:hcw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    O3303_05520 (accC)
   00640 Propanoate metabolism
    O3303_05520 (accC)
  09102 Energy metabolism
   00720 Other carbon fixation pathways
    O3303_05520 (accC)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    O3303_05520 (accC)
Enzymes [BR:hcw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     O3303_05520 (accC)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     O3303_05520 (accC)
SSDB
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp GARS_A ATP-grasp_3 RimK ATPgrasp_ST ATP-grasp_4 ATP-grasp_5
Other DBs
NCBI-ProteinID: WBA43023
UniProt: A0ABY7LRH9
LinkDB
Position
complement(1260396..1261907)
AA seq 503 aa
MKKITKLLVANRGEIALRVLRSAKEMGLQTVAIYSEADRNALHVRYADEAVCVGPPASKD
SYLRGDKILEVCRQLGVDAIHPGYGFLSENAEFARMVTEAGLIFVGPSPEAMNLMGDKLS
AKQAVKAYNIPLVPGTDEAISDVEEAKRIAATVGFPILIKASAGGGGKGMRIVNSAEDFE
EQMQLAINEAVSAFGDGAVFIEKFVTGPRHIEIQVLGDEHGNIVHLFERECSIQRRHQKV
IEEAPSAVLTPELRAEMGRCAVDVARACNYTGAGTVEFLLDDQHNFYFLEMNTRLQVEHP
VTEQITGLDLVKEQIKVAQGLPLAFQQEDLSINGHALELRVYAEDPQNNFLPDIGTLTTY
VRPQGPGVRVDDGFEQGMEIPIYYDPMIAKLVTFGATREEAIARMLRAIEEYQITGIETT
LGFGRYVLQHPAFVSGNFDTNFIRDHFPADALKPTAPDEATAKLAAVLTAMLLTDKKPGA
TAASAEAPTATGSAWKRNRLGVR
NT seq 1512 nt   +upstreamnt  +downstreamnt
atgaaaaaaatcaccaagctgctcgtggccaaccgcggcgaaattgcgttgcgcgtgctg
cgctcggccaaggaaatgggcctccagaccgtggccatctactccgaggccgaccgcaac
gccctgcacgtacgctacgccgatgaggccgtgtgcgtgggcccgcccgccagcaaagac
agctacctgcgcggcgacaaaattctggaagtctgccgccagctgggcgtcgatgccatt
caccccggctacggcttcctgagcgaaaacgccgaatttgcccgcatggtcacggaggcc
gggctgattttcgtggggccttcgccggaagccatgaacctgatgggcgacaagctctca
gccaagcaggccgtgaaagcctacaacatcccgctggtgcccggcaccgacgaggccatt
tccgacgtggaggaggccaagcgcattgctgccacggtgggcttccccatcctgatcaag
gcttcggccggcggtggcggcaagggcatgcgcatcgtgaattcggccgaggatttcgag
gagcagatgcagttggccatcaacgaggccgtgtcagctttcggcgacggagccgtattc
attgagaagttcgtgaccggcccgcgccacatcgaaattcaggtgctcggcgacgagcac
ggcaacatcgtgcacctgttcgagcgggaatgctcgattcagcgccgccaccagaaggtg
attgaggaagcgccctcggcggtgctcacgcccgagctgcgcgccgaaatgggccgctgc
gccgtggacgtggcccgagcctgcaactacaccggggccggcaccgtggagtttctgctc
gatgaccagcacaacttctacttcctggagatgaacacccgcctgcaggtggagcacccc
gtgacggagcagattacgggcctcgacctagtgaaggagcagatcaaggtggcccagggc
ttgcccctcgccttccagcaggaagacctgagcatcaacggccacgccctggagctgcgc
gtgtacgccgaggacccgcagaacaacttcctgcctgacatcgggacgctgaccacctac
gtgcgcccccagggccccggcgtacgcgtcgacgacggcttcgagcagggcatggaaatc
ccgatctactacgacccgatgattgccaagctcgtcaccttcggggctacccgcgaggag
gccattgcccggatgctgcgtgccattgaggagtaccagattaccggcatcgaaaccacg
ctgggcttcggccgctacgtgctgcagcacccggccttcgtgagcggcaacttcgacacc
aacttcatccgcgaccatttcccggccgacgccctgaaacccaccgccccggacgaagcc
accgccaagctcgccgccgtgctcaccgccatgctcctgacggacaagaaacccggtgcc
accgccgcttctgctgaagcaccaaccgctaccggctccgcttggaagcggaaccggctg
ggggtgcggtag

DBGET integrated database retrieval system