Hymenobacter canadensis: O3303_21010 Help Entry O3303_21010       CDS       T09156                                  Name (GenBank) hypothetical protein   KO K03503   DNA polymerase V [EC:3.4.21.-] Organism hcw  Hymenobacter canadensis Brite KEGG Orthology (KO) [BR:hcw00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:hcw01002]     O3303_21010   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:hcw03400]     O3303_21010 Peptidases and inhibitors [BR:hcw01002]  Serine peptidases   Family S24: LexA family    O3303_21010 DNA repair and recombination proteins [BR:hcw03400]  Prokaryotic type   TLS (translesion DNA synthesis) factors    Y-family DNA polymerases     O3303_21010 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Peptidase_S24 Motif Other DBs NCBI-ProteinID:  WBA44044 UniProt:  A0ABY7LUG5 LinkDB All DBs Position unnamed1:347511..347792 Genome browser AA seq 93 aa AA seqDB search MASCPASSHSCTWWFASSSSSDELEEFFDLNRILFRHPEATYLIRVSGESMRGAEIHADD GFYRSARALAGQGPTQKPGVYYPAVGSDGRWVG NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggctagttgtccggcatcctcgcattcgtgtacgtggtggttcgccagtagcagctcc tccgacgagctcgaggagttctttgacctcaaccgcatcctgttccgccaccccgaggcc acgtacctgatccgagtgtcgggcgagagcatgcggggcgccgaaatccatgccgacgat ggcttctaccggtcagcccgcgccctggcagggcaaggcccaacacaaaagccaggcgtt tactacccggctgtaggatctgatggtcgttgggtaggctag

DBGET integrated database retrieval system