Natronorubrum daqingense: BB347_10205 Help Entry BB347_10205       CDS       T04679                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hda  Natronorubrum daqingense Pathway hda03010   Ribosome Brite KEGG Orthology (KO) [BR:hda00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     BB347_10205   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     BB347_10205  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hda03011]     BB347_10205    04121 Ubiquitin system [BR:hda04121]     BB347_10205   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hda04147]     BB347_10205 Ribosome [BR:hda03011]  Ribosomal proteins   Eukaryotes    Small subunit     BB347_10205   Archaea     BB347_10205 Ubiquitin system [BR:hda04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    BB347_10205 Exosome [BR:hda04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    BB347_10205   Exosomal proteins of colorectal cancer cells    BB347_10205 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 Zn_ribbon_RPB9 FYVE Zn_Ribbon_TF Ribosomal_L37e zf-Tbcl_FmdE Cas12f1-like_TNB Zn_ribbon_3 Zn_ribbon_RPAB4 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  APX96963 UniProt:  A0A1N7CM51 LinkDB All DBs Position complement(2103369..2103539) Genome browser AA seq 56 aa AA seqDB search MPTRKPKRRKPKMARHELYGDDGTTEREQCPRCGDAFLADHGDRTHCGKCGYTEWE NT seq 171 nt NT seq  +upstreamnt  +downstreamnt atgccgacgcggaagccgaagcggaggaagcctaagatggcccgacacgaactctacggc gacgacggaaccacggagcgagaacagtgtccacgatgcggagacgcgttcctcgcagac cacggtgaccgcacgcactgcggtaagtgtggctacaccgagtgggagtaa

DBGET integrated database retrieval system