Natronorubrum daqingense: BB347_10725 Help Entry BB347_10725       CDS       T04679                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hda  Natronorubrum daqingense Pathway hda03010   Ribosome Brite KEGG Orthology (KO) [BR:hda00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     BB347_10725   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     BB347_10725  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hda03011]     BB347_10725    04121 Ubiquitin system [BR:hda04121]     BB347_10725 Ribosome [BR:hda03011]  Ribosomal proteins   Eukaryotes    Large subunit     BB347_10725   Archaea     BB347_10725 Ubiquitin system [BR:hda04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    BB347_10725 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 zf-CHY DZR Ribosomal_L37e Zn_ribbon_3 Zn_ribbon_RPAB4 Motif Other DBs NCBI-ProteinID:  APX97057 UniProt:  A0A1N7CU94 LinkDB All DBs Position 2217007..2217156 Genome browser AA seq 49 aa AA seqDB search MASFDAAEKRTLEKMICMRCNARNSQSADSCRKCGYKNLRPKAKEARAA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggccagtttcgacgccgcagaaaaacgaacgctagagaaaatgatctgcatgcgctgt aacgcccgtaactcccagagtgcggacagttgccgcaagtgcggttacaagaacctccga ccgaaggcgaaagaagcccgcgcagcataa

DBGET integrated database retrieval system