Halalkaliarchaeum desulfuricum: AArcSl_1357 Help Entry AArcSl_1357       CDS       T06283                                  Name (GenBank) hypothetical protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hdf  Halalkaliarchaeum desulfuricum Pathway hdf00280   Valine, leucine and isoleucine degradation hdf00630   Glyoxylate and dicarboxylate metabolism hdf00640   Propanoate metabolism hdf01100   Metabolic pathways hdf01110   Biosynthesis of secondary metabolites hdf01120   Microbial metabolism in diverse environments hdf01200   Carbon metabolism Module hdf_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hdf00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     AArcSl_1357    00640 Propanoate metabolism     AArcSl_1357   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     AArcSl_1357 Enzymes [BR:hdf01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      AArcSl_1357     6.4.1.3  propionyl-CoA carboxylase      AArcSl_1357 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AUX08988 UniProt:  A0A343TIR6 LinkDB All DBs Position complement(1383483..1383737) Genome browser AA seq 84 aa AA seqDB search MQLHIPEDASDEEAAAIAAAIGAHLRDRAAAAAAAADSEPTWDDKRWAFAGRIEGLGTRG ARDFRLREGTPTDPWTASGRRDRF NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgcaactccacattcccgaggacgcgtccgacgaggaggcggcggcgatcgccgcggcg atcggcgcccatctccgggatcgggcggccgccgcggcagccgccgccgactcggagccg acctgggacgacaagcgatgggcgttcgcgggtcgcatcgagggtctcggcacccgcggc gcgcgcgatttccgactccgggaggggacgccgacggatccctggaccgccagcgggcgc cgggatcggttctaa

DBGET integrated database retrieval system