Pikeienuella piscinae: G5B40_03160 Help Entry G5B40_03160       CDS       T06458                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hdh  Pikeienuella piscinae Pathway hdh01100   Metabolic pathways hdh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hdh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5B40_03160   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5B40_03160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QIE54519 UniProt:  A0A7L5BY39 LinkDB All DBs Position complement(670393..670632) Genome browser AA seq 79 aa AA seqDB search MSDIADRVKKIVVEHLGVEEEKVVEKASFIDDLGADSLDTVELVMAFEEEFGIEIPDDAA ETIQTFGDAVKFISENADA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgacatcgcggatcgcgtgaaaaagatcgtcgtcgagcatctgggcgtcgaagag gaaaaagtcgtcgagaaggccagctttatcgacgatcttggcgcggacagtctcgacacg gtcgagttggtcatggcgttcgaagaggagttcgggatcgagatcccggacgatgcggcc gagacaattcaaaccttcggcgacgcggtgaagttcatctccgagaacgctgacgcctga

DBGET integrated database retrieval system