Pikeienuella piscinae: G5B40_10595 Help Entry G5B40_10595       CDS       T06458                                  Symbol grxC Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism hdh  Pikeienuella piscinae Brite KEGG Orthology (KO) [BR:hdh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hdh03110]     G5B40_10595 (grxC) Chaperones and folding catalysts [BR:hdh03110]  Protein folding catalysts   Protein disulfide isomerase    G5B40_10595 (grxC) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_3 GST_N_2 Glrx-like SH3BGR Motif Other DBs NCBI-ProteinID:  QIE55859 UniProt:  A0A7L5C1X2 LinkDB All DBs Position complement(2196106..2196363) Genome browser AA seq 85 aa AA seqDB search MNTVEIYTTPICGYCRMAKRLLDEKGVSYVETDVMADPSKRVEMTKRAEGGRTVPQIFIG GAHVGGCDELYALERSGRLDRILAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaacacggttgaaatctacaccacgccgatctgcggctattgccgcatggcgaagcgc ctccttgacgaaaagggggtcagctatgtcgaaaccgacgtaatggccgacccttcgaaa cgggtggagatgacgaagcgcgccgaaggcggtcggacggtgccccagatattcatcggc ggcgcgcatgtcggcggctgcgacgaactctatgcgttggagcgttcggggcgactggac cggattctcgccgcttga

DBGET integrated database retrieval system