KEGG   Pikeienuella piscinae: G5B40_13765
Entry
G5B40_13765       CDS       T06458                                 
Symbol
petA
Name
(GenBank) ubiquinol-cytochrome c reductase iron-sulfur subunit
  KO
K00411  ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:7.1.1.8]
Organism
hdh  Pikeienuella piscinae
Pathway
hdh00190  Oxidative phosphorylation
hdh01100  Metabolic pathways
hdh02020  Two-component system
hdh04148  Efferocytosis
Module
hdh_M00151  Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:hdh00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    G5B40_13765 (petA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    G5B40_13765 (petA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04148 Efferocytosis
    G5B40_13765 (petA)
Enzymes [BR:hdh01000]
 7. Translocases
  7.1  Catalysing the translocation of protons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.8  quinol---cytochrome-c reductase
     G5B40_13765 (petA)
SSDB
Motif
Pfam: UCR_Fe-S_N Rieske DUF3493
Other DBs
NCBI-ProteinID: QIE56433
UniProt: A0A7L5BZA4
LinkDB
Position
2903677..2904237
AA seq 186 aa
MGPVSEAIGTRRDFLYVATGAAATVGVGAAVWPLVDQMNPSADVRALASIDVDISGVEEG
TQLTVKFLGKPIFIRHRTQEEIEAAREVDVSTLRDQVARNPNIAGDAIADDKNRTIGDRE
DWLVMIGVCTHLGCVPLGNAGDFGGWFCPCHGSHYDTAGRIRKGPAPENMHVPIASYPDE
NTVKLG
NT seq 561 nt   +upstreamnt  +downstreamnt
atgggacccgtgtccgaagcaattggaacccgccgcgactttctctatgtcgcgaccggc
gccgcagccaccgtgggcgttggcgccgccgtctggccgctggtggaccagatgaacccg
agcgccgacgtgcgcgcgctcgcctcgattgatgtggatatttccggcgtcgaggagggc
acccagctcaccgtcaagttcctcggcaagccgatcttcatccgtcaccgcacgcaggaa
gagatcgaggcggcccgcgaagtcgatgtcagcacgctgcgcgatcaggtcgcgcgcaac
cccaacatcgcgggcgacgcgatcgcggacgacaagaaccgcaccatcggcgaccgcgag
gactggctggtgatgatcggtgtctgcacgcatctcggctgcgttccgttgggcaacgcc
ggtgatttcggcggctggttctgcccttgccacggctcgcattacgacaccgcgggccgc
atccgcaaaggccccgcgccggagaacatgcatgttccgatcgcgtcatatccggacgaa
aacaccgtcaagctcggctga

DBGET integrated database retrieval system