Pikeienuella piscinae: G5B40_16015 Help Entry G5B40_16015       CDS       T06458                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hdh  Pikeienuella piscinae Pathway hdh01100   Metabolic pathways hdh01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hdh00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     G5B40_16015    00074 Mycolic acid biosynthesis     G5B40_16015   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     G5B40_16015 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QIE57932 UniProt:  A0A7M3T7F1 LinkDB All DBs Position complement(3371965..3372192) Genome browser AA seq 75 aa AA seqDB search MLSELSEIFADVMDLDEVELRDATTAEDIEEWDSLSNIRLVVSIERKYKIKFANAEIEAL RCVGDLVDTIIRKTS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt attctttctgaactctcagagattttcgccgatgtgatggacctcgacgaggttgaactc cgggacgccacaaccgccgaagatatcgaggaatgggacagtctcagcaatatccggctg gtcgtctccatagagcgcaaatacaagataaagttcgccaacgccgagatcgaggcgctg cgctgcgtcggcgacctcgtggacaccatcatccgcaagacgtcctga

DBGET integrated database retrieval system