Pikeienuella piscinae: G5B40_16945 Help Entry G5B40_16945       CDS       T06458                                  Name (GenBank) hypothetical protein   KO K02395   peptidoglycan hydrolase FlgJ Organism hdh  Pikeienuella piscinae Pathway hdh02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:hdh00001]  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     G5B40_16945  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:hdh02035]     G5B40_16945 Bacterial motility proteins [BR:hdh02035]  Flagellar system   Flagellar assembly proteins    Rod and hook     G5B40_16945 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Rod-binding Motif Other DBs NCBI-ProteinID:  QIE57944 UniProt:  A0A7M3T7G3 LinkDB All DBs Position 3566726..3567016 Genome browser AA seq 96 aa AA seqDB search MTAASETRPLAETRAGETREAALRKAATSFEAVFLSEMFAHVGLGAVREGNGGGVGEEAF ASLLADEWAEKVASAGGLGLSERIYQALATREDGDA NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaccgccgcgtccgaaacccgacctctggccgagacgcgcgccggtgaaacccgcgaa gcggcgcttcgcaaggccgcgacctcattcgaggcggtcttcctctcggagatgttcgcc catgtcgggctgggcgccgtgcgagagggcaatggcggcggtgtgggagaggaggcgttc gccagtcttctcgccgacgaatgggccgagaaggtcgcatcggcaggcgggctggggctg tcggagcggatctatcaggcgctcgcgacgcgggaggatggcgatgcttga

DBGET integrated database retrieval system