Halobacterium sp. DL1: HALDL1_12625 Help Entry HALDL1_12625      CDS       T03878                                  Name (GenBank) acc operon protein   KO K22568   acetyl-CoA/propionyl-CoA carboxylase, PccX subunit [EC:6.4.1.2 6.4.1.3] Organism hdl  Halobacterium sp. DL1 Pathway hdl00280   Valine, leucine and isoleucine degradation hdl00630   Glyoxylate and dicarboxylate metabolism hdl00640   Propanoate metabolism hdl01100   Metabolic pathways hdl01110   Biosynthesis of secondary metabolites hdl01120   Microbial metabolism in diverse environments hdl01200   Carbon metabolism Module hdl_M00741   Propanoyl-CoA metabolism, propanoyl-CoA => succinyl-CoA Brite KEGG Orthology (KO) [BR:hdl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00630 Glyoxylate and dicarboxylate metabolism     HALDL1_12625    00640 Propanoate metabolism     HALDL1_12625   09105 Amino acid metabolism    00280 Valine, leucine and isoleucine degradation     HALDL1_12625 Enzymes [BR:hdl01000]  6. Ligases   6.4  Forming carbon-carbon bonds    6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)     6.4.1.2  acetyl-CoA carboxylase      HALDL1_12625     6.4.1.3  propionyl-CoA carboxylase      HALDL1_12625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  AHG04344 LinkDB All DBs Position complement(2075991..2076248) Genome browser AA seq 85 aa AA seqDB search MPPEEYDVAVPDDASDEEAAAIAAAVSAHLAALEAAAAEGEEGPTWTGRKWSFAGRIEAL DGGPVRVPDGAPTDAWSAAGRRDRF NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgccccccgaggagtacgacgtcgcggttcccgacgacgccagcgacgaggaggcggcc gccatcgccgccgctgtcagcgcccacctcgcggccctcgaagccgcggccgcggagggc gaggagggaccgacgtggaccggccgcaagtggtcgttcgccgggcgcatcgaggctctc gacggggggccagtgcgcgtgccggacggcgcgccgacggacgcctggagcgcggcgggc cgccgcgaccggttctga

DBGET integrated database retrieval system