Hyphomicrobium denitrificans ATCC 51888: Hden_3189 Help Entry Hden_3189         CDS       T01265                                  Name (GenBank) glutaredoxin 3   KO K03676   glutaredoxin 3 Organism hdn  Hyphomicrobium denitrificans ATCC 51888 Brite KEGG Orthology (KO) [BR:hdn00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:hdn03110]     Hden_3189 Chaperones and folding catalysts [BR:hdn03110]  Protein folding catalysts   Protein disulfide isomerase    Hden_3189 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_2 Motif Other DBs NCBI-ProteinID:  ADJ24984 UniProt:  D8JWM6 LinkDB All DBs Position 3264288..3264560 Genome browser AA seq 90 aa AA seqDB search MHKVTVYTAGNCCYCHMAKDLLRRKGAAFEEIDLTGRSDLRADLRARAGGRHTVPQIWIG SVHVGGCDDLFDLERSGKLDALLAQTTSAS NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgcataaggtgacggtctacacggctggaaactgctgttactgccacatggcaaaggat ctgctgagacgcaaaggagcggcgttcgaggagatcgatctgacgggccgaagcgatttg cgcgcggacttgagagcccgcgcgggcgggcggcacacggtgccgcaaatctggatcggc agcgttcacgtcggcggttgcgatgatcttttcgatctcgaacgctccggcaagctcgac gcgcttctcgcacagacgacttcggcatcgtga

DBGET integrated database retrieval system