Halococcus dombrowskii: MUK72_02480 Help Entry MUK72_02480       CDS       T08074                                  Name (GenBank) 50S ribosomal protein L40e   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism hdo  Halococcus dombrowskii Pathway hdo03010   Ribosome Brite KEGG Orthology (KO) [BR:hdo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MUK72_02480   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MUK72_02480  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hdo03011]     MUK72_02480    04121 Ubiquitin system [BR:hdo04121]     MUK72_02480 Ribosome [BR:hdo03011]  Ribosomal proteins   Eukaryotes    Large subunit     MUK72_02480   Archaea     MUK72_02480 Ubiquitin system [BR:hdo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MUK72_02480 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_L40e Zn_Ribbon_1 DZR zf-CHY DZR_2 DUF6395 Motif Other DBs NCBI-ProteinID:  UOO95588 UniProt:  A0AAX3ASF0 LinkDB All DBs Position 469030..469179 Genome browser AA seq 49 aa AA seqDB search MARFDQAEARILEKMICMRCNARNPAGADSCRKCGYKNLRRKARERRSA NT seq 150 nt NT seq  +upstreamnt  +downstreamnt atggccagattcgaccaggcggaagcgcgcattctcgagaagatgatctgcatgcgctgt aacgcccgcaaccctgccggagcggacagctgtcggaagtgcggctacaagaaccttcgt cggaaggcccgcgagcgccgcagcgcctga

DBGET integrated database retrieval system