Halococcus dombrowskii: MUK72_04585 Help Entry MUK72_04585       CDS       T08074                                  Name (GenBank) 30S ribosomal protein S27ae   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism hdo  Halococcus dombrowskii Pathway hdo03010   Ribosome Brite KEGG Orthology (KO) [BR:hdo00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     MUK72_04585   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     MUK72_04585  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:hdo03011]     MUK72_04585    04121 Ubiquitin system [BR:hdo04121]     MUK72_04585   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:hdo04147]     MUK72_04585 Ribosome [BR:hdo03011]  Ribosomal proteins   Eukaryotes    Small subunit     MUK72_04585   Archaea     MUK72_04585 Ubiquitin system [BR:hdo04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    MUK72_04585 Exosome [BR:hdo04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    MUK72_04585   Exosomal proteins of colorectal cancer cells    MUK72_04585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ribosomal_S27 FYVE Prok-RING_1 Zn_ribbon_RPB9 Cas12f1-like_TNB Zn_ribbon_IS1595 Zn_ribbon_PaaD Zn_ribbon_RPAB4 Zn_ribbon_TFIIB Zn_ribbon_3 Ribosomal_L37e RPA_interact_C DUF7575 Zn_Ribbon_TF Zn_ribbon_5 Zn_ribbon_19 zf-C2H2_FBX41 Motif Other DBs NCBI-ProteinID:  UOO95987 UniProt:  A0AAV3SK53 LinkDB All DBs Position complement(849829..849963) Genome browser AA seq 44 aa AA seqDB search MARHELYDEDGSTDREQCPRCGDAFLAAHDDRVHCGRCGYTEWN NT seq 135 nt NT seq  +upstreamnt  +downstreamnt atggcccgccacgagctctacgacgaggacggctcgactgaccgcgagcagtgcccccgc tgtggtgacgcctttctcgccgcccacgacgaccgcgtgcactgcgggcgctgtggctac accgagtggaactga

DBGET integrated database retrieval system