Hyphomicrobium denitrificans 1NES1: HYPDE_30433 Help Entry HYPDE_30433       CDS       T02646                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hdt  Hyphomicrobium denitrificans 1NES1 Pathway hdt01100   Metabolic pathways hdt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hdt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HYPDE_30433 (acpP)    00074 Mycolic acid biosynthesis     HYPDE_30433 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HYPDE_30433 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N TRI4_N Motif Other DBs NCBI-ProteinID:  AGK57761 UniProt:  N0BB49 LinkDB All DBs Position complement(1578710..1578952) Genome browser AA seq 80 aa AA seqDB search MSDVAERVKKIVVEHLGVEADKVTDNASFIDDLGADSLDTVELVMAFEEEFGCEIPDDAA EHILTVGDAVKFLEKNASAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgagcgatgttgcagagcgcgtgaagaaaattgtcgtagagcatcttggcgtcgaggca gacaaggtcacggacaacgccagcttcatcgacgatcttggcgcggatagcttggatacg gttgaactggtgatggcgttcgaagaagaattcggatgcgagatccccgatgatgccgct gagcacatcctcaccgtcggcgatgctgtaaagtttctggagaagaacgccagcgcggcc tga

DBGET integrated database retrieval system