KEGG   Haemophilus ducreyi: HD_1316
Entry
HD_1316           CDS       T00135                                 
Symbol
sanA
Name
(GenBank) SanA protein
  KO
K03748  SanA protein
Organism
hdu  Haemophilus ducreyi
Brite
KEGG Orthology (KO) [BR:hdu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    HD_1316 (sanA)
SSDB
Motif
Pfam: DUF218 Zip
Other DBs
NCBI-ProteinID: AAP96137
UniProt: Q7VLU7
LinkDB
Position
1072503..1073195
AA seq 230 aa
MMWISNNSVRRLAGRLIRCLKCVAAGLLLAASMLLMVDGLTSWYVKDRLFTDIDQLPARP
YAVVLGTAKFYASGELNLYYHYRLAAAAALYQQAKVDKLLVSGDNQTVYYNEPKVMRNDL
VNMGVPASQVEQDFAGFRTLDSIIRAKQVYQLAPFVIVSQRFHCERALFIAKYYDIDAVC
FAAKYPAGHIQVRVREFFARLGMLWDLLMHTQPDSLVKVDAKEIKSGNKR
NT seq 693 nt   +upstreamnt  +downstreamnt
atgatgtggataagcaataatagcgtgcgaaggttggcggggcggttgatacgttgcttg
aagtgtgtggcagcggggctgttgttggcggcgtcgatgttgttaatggtggatggttta
accagttggtatgtaaaggatcggttgtttacggatattgatcaattgccggcacggcct
tatgcggtggtgttgggcacggcaaaattttatgcaagcggtgagttaaatctttattat
cattatcggttggctgcggcagcggcgttatatcagcaggcgaaggtggataagttgttg
gtgagtggcgataatcaaacggtttattataatgagcctaaagtgatgcgcaatgattta
gtgaatatgggtgtgccggctagccaggttgagcaagattttgcgggctttcgcacgtta
gattcgattattcgtgctaagcaggtttatcaattggcgccgtttgtgattgtttcgcaa
cgttttcattgtgagcgggcgttatttattgctaaatattatgatattgatgcggtctgt
tttgcggctaaatatcctgcggggcatattcaggtgcgggtgcgggagttttttgcgcgg
ttaggaatgttatgggatttgttgatgcatacgcaacctgatagtttggttaaggtggat
gcgaaggagatcaaaagtgggaataaacgctag

DBGET integrated database retrieval system