Haemophilus ducreyi: HD_1472 Help Entry HD_1472           CDS       T00135                                  Name (GenBank) conserved hypothetical protein   KO K09892   cell division protein ZapB Organism hdu  Haemophilus ducreyi Brite KEGG Orthology (KO) [BR:hdu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:hdu03036]     HD_1472 Chromosome and associated proteins [BR:hdu03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     HD_1472 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB DUF7491 YabA APG6_N DUF7801 ERM_helical DUF3450 DIMCO_N Tropomyosin GAS DUF2968 TMF_DNA_bd DLP_helical Cluap1 GrpE DUF5660 Bap31_Bap29_C CCDC-167 DegS Mis12 FtsL Herpes_UL6 Spc7 ADIP UPF0242 COG3_N Phage_GPO bZIP_1 Sipho_Gp157 zf-C4H2 NPV_P10 DivIC DUF7792 TSC22 K-box Sec20 BLOC1_2 ATG14 V_ATPase_I Prominin FapA ZYG-11_interact Motif Other DBs NCBI-ProteinID:  AAP96274 UniProt:  Q7VLH3 LinkDB All DBs Position 1207580..1207798 Genome browser AA seq 72 aa AA seqDB search MSLSIIDQLEEKIKQAVETIQLLQLEVEELKEKNNNLTQERDGLRQEHEQLKVEQQNFQE RLRSLLGQIDNV NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgtcattatcaattattgatcaacttgaagaaaaaattaaacaagcggtcgaaacaatc caattgctacaattagaagttgaagagttaaaagaaaaaaataacaatcttactcaagaa agagatggattacgtcaagaacacgaacaattaaaagtagaacaacagaacttccaagag cgtttacgatcacttttaggccaaattgataatgtatag

DBGET integrated database retrieval system