Haemophilus ducreyi: HD_1931 Help Entry HD_1931           CDS       T00135                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hdu  Haemophilus ducreyi Pathway hdu01100   Metabolic pathways hdu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hdu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HD_1931 (acpP)    00074 Mycolic acid biosynthesis     HD_1931 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HD_1931 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 Motif Other DBs NCBI-ProteinID:  AAP96652 UniProt:  Q7VKH6 LinkDB All DBs Position 1622630..1622863 Genome browser AA seq 77 aa AA seqDB search MSIEERVKKIIVDQLGVKAEDVKPEASFIEDLGADSLDTVELVMALEEEFDIEIPDEEAE KITTVQSAIDYVAKANA NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcattgaagaacgcgtaaaaaaaatcatcgttgatcaattaggtgttaaagctgaa gatgtaaaaccagaagcttcattcattgaagacttaggtgcagactctttagacacggtt gaattagtgatggctttagaagaagaattcgatatcgaaattccagacgaagaagctgaa aaaatcactacagttcaatctgcaattgattacgtggcaaaagctaacgcataa

DBGET integrated database retrieval system