Halarcobacter ebronensis: AEBR_0444 Help Entry AEBR_0444         CDS       T06616                                  Symbol acpP1 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hebr  Halarcobacter ebronensis Pathway hebr01100   Metabolic pathways hebr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hebr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AEBR_0444 (acpP1)    00074 Mycolic acid biosynthesis     AEBR_0444 (acpP1)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AEBR_0444 (acpP1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF7080 DUF1002 Transcrip_reg Motif Other DBs NCBI-ProteinID:  QKF80953 LinkDB All DBs Position complement(434297..434527) Genome browser AA seq 76 aa AA seqDB search MALLDDVKEVVVEQLDCDPAEVKEESKFIEDLGADSLDVVELVMALEEKFDIEIPDEDAE KILTVADAIKYIEDNA NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgatgtgaaagaagtagtagttgagcaacttgattgtgatccggct gaagttaaagaagaatctaaattcatcgaggacttaggtgctgactctttagacgttgtt gaattagttatggcgttagaagaaaaattcgatatcgaaatccctgatgaagatgcagaa aagattttaactgtagctgatgctattaaatacatcgaagataacgcgtaa

DBGET integrated database retrieval system