KEGG   Herbaspirillum sp. meg3: hmeg3_05600
Entry
hmeg3_05600       CDS       T05024                                 
Name
(GenBank) tRNA pseudouridine(55) synthase TruB
  KO
K03177  tRNA pseudouridine55 synthase [EC:5.4.99.25]
Organism
hee  Herbaspirillum sp. meg3
Brite
KEGG Orthology (KO) [BR:hee00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hee03016]
    hmeg3_05600
Enzymes [BR:hee01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.25  tRNA pseudouridine55 synthase
     hmeg3_05600
Transfer RNA biogenesis [BR:hee03016]
 Eukaryotic type
  tRNA modification factors
   Psudouridine synthases
    hmeg3_05600
 Prokaryotic type
    hmeg3_05600
SSDB
Motif
Pfam: TruB_N TruB_C_2 TruB-C_2
Other DBs
NCBI-ProteinID: ASU37824
LinkDB
Position
1227470..1228423
AA seq 317 aa
MAHSSPSQPRPPKIPRVPVHGVLLLDKSVGWSSNDALIKAKRLLNALKAGHTGTLDPFAT
GLLPLCFGEATKFSQDLLEADKTYEAVVHLGIVTNTGDTEGEVLGTKPVNVSLAQIASAL
QQFRGEISQVPPMHSALKRDGKPLYEYARAGITLEREARKVTIHQLELLGYEAPFLRIRV
MCSKGTYIRVLGEDIGALLGCGAHLNQLRRTGVGALTLEGSVTLDQFIALDDSQRTQALL
PVDGLLTTFPAVMLTDVLTERFLHGQRLALGKEGIALPAESGRARVYQESNGRLLGTGLM
QEFGILAPERLISTLSN
NT seq 954 nt   +upstreamnt  +downstreamnt
atggcgcattcttcgccttcgcaacctcgccctcccaagattccgcgcgtgcccgtacat
ggtgtgttgctgctggataagtcagtgggctggtccagtaacgacgcattgatcaaagcc
aagcgcctgcttaatgcgctaaaggccgggcataccggcacgctcgatccgtttgcgacc
ggcttgctgccgctgtgcttcggcgaggcgaccaagttttcgcaggatttgctggaggcg
gacaagacctatgaggcggttgtccatctgggtatcgtcaccaacaccggcgacaccgaa
ggggaagtgctcggcaccaaaccggtcaatgtcagccttgcgcagatcgcgtcggcgttg
cagcagtttcgcggcgagatttcgcaagtgccgccgatgcattccgcgctcaagcgtgac
ggcaagcccttgtacgaatatgcgcgcgcaggtatcacgctggagcgtgaagcgcgcaag
gtaacgattcatcagttggagttgctcggctatgaagcgccttttttgcgtatccgcgtg
atgtgcagcaagggcacttatattcgcgtgcttggcgaagatatcggcgcattgcttggt
tgtggcgcccatttgaatcaattgcgccgtaccggtgtcggtgcgttgacgctggagggc
agtgtgacgctcgatcagttcatcgcactcgacgacagccaacgcacgcaagccttgctg
ccggtggacggtttgctgacgacttttccggcggtgatgctgacggatgtgctgaccgag
cgcttcttgcacgggcagcgtctggcgcttggcaaggaaggtattgcgttgccagcagaa
tcaggccgggcaagggtttatcaggaaagtaacgggcgccttctgggcaccggtttaatg
caggaattcggcatactggcgccggaaaggctgatttcgactttgtcgaactag

DBGET integrated database retrieval system