Helicobacter pylori F16: HPF16_0799 Help Entry HPF16_0799        CDS       T01910                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hef  Helicobacter pylori F16 Pathway hef01100   Metabolic pathways hef01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hef00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPF16_0799 (acpP)    00074 Mycolic acid biosynthesis     HPF16_0799 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPF16_0799 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BAJ55396 LinkDB All DBs Position 825101..825337 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttaaatgtggatgcggca caagttacgccagaggcggaatttgtaaaggatttgggtgcagactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system