Helicobacter pylori Gambia94/24: HPGAM_02870 Help Entry HPGAM_02870       CDS       T01917                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism heg  Helicobacter pylori Gambia94/24 Pathway heg01100   Metabolic pathways heg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:heg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPGAM_02870 (acpP)    00074 Mycolic acid biosynthesis     HPGAM_02870 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPGAM_02870 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 DUF1493 DUF2624 Motif Other DBs NCBI-ProteinID:  ADU81414 LinkDB All DBs Position complement(576761..576997) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFNIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattgatcatggcgttagaagaaaagtttaacattgaaattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtaaagtatattgaggacaataaactggcttaa

DBGET integrated database retrieval system