Herbiconiux sp. L3-i23: L3i23_14170 Help Entry L3i23_14170       CDS       T08550                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism heh  Herbiconiux sp. L3-i23 Pathway heh03060   Protein export heh03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:heh00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     L3i23_14170  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     L3i23_14170  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:heh02044]     L3i23_14170 Secretion system [BR:heh02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    L3i23_14170 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E PEX14-like_2nd Motif Other DBs NCBI-ProteinID:  BDI22641 LinkDB All DBs Position 1508985..1509239 Genome browser AA seq 84 aa AA seqDB search MLGNLTGWHFLIVLIVILLVFGATKLPALAKSVGQSMKIFRNEIQTDKVETEKRDAETPV VYTEEPPAGMAAPAASEPDHKPEK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgctcggtaatctcaccggttggcacttcctgatcgtcctcatcgtgatcctgctcgtc ttcggggccacgaagctccccgcgctcgccaagagcgtcggccagtcgatgaagatcttc cgcaacgagatccagaccgacaaggtcgagaccgagaagcgcgacgccgagacccccgtg gtgtacacggaggaacctcccgccgggatggcggccccggcggccagcgagcctgatcac aagccagagaagtag

DBGET integrated database retrieval system