Halomonas elongata: HELO_1999 Help Entry HELO_1999         CDS       T01311                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hel  Halomonas elongata Pathway hel01100   Metabolic pathways hel01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hel00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HELO_1999 (acpP)    00074 Mycolic acid biosynthesis     HELO_1999 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HELO_1999 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Bac_DnaA_C HLH Motif Other DBs NCBI-ProteinID:  CBV41883 UniProt:  E1V9P9 LinkDB All DBs Position 1150083..1150316 Genome browser AA seq 77 aa AA seqDB search MSTIEERVKKVVAERLNVKEEDIQSSSSFTEDLGADSLDTVELVMALEEEFDTEIPDEEA EKITTVQEAIDYVNAHQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagagcgcgtgaagaaggttgtggccgagcgcctgaacgtcaaggaa gaggacatccagagctcatcttccttcaccgaggatctcggtgccgattccctggatacc gtcgagctggtgatggcgctcgaagaggaattcgataccgaaattcccgacgaggaagcc gagaagatcaccaccgttcaggaagccatcgactacgtcaacgcccaccagtaa

DBGET integrated database retrieval system