Helicobacter pylori SNT49: HPSNT_02880 Help Entry HPSNT_02880       CDS       T01916                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hen  Helicobacter pylori SNT49 Pathway hen01100   Metabolic pathways hen01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hen00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPSNT_02880 (acpP)    00074 Mycolic acid biosynthesis     HPSNT_02880 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPSNT_02880 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N ACP_SdgA_C PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AEN16735 UniProt:  G2ME54 LinkDB All DBs Position complement(585395..585631) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcattgagattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system