KEGG   Helicobacter pylori Puno120: HPPN120_07220
Entry
HPPN120_07220     CDS       T01919                                 
Symbol
coaD
Name
(GenBank) phosphopantetheine adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
hep  Helicobacter pylori Puno120
Pathway
hep00770  Pantothenate and CoA biosynthesis
hep01100  Metabolic pathways
hep01240  Biosynthesis of cofactors
Module
hep_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:hep00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    HPPN120_07220 (coaD)
Enzymes [BR:hep01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     HPPN120_07220 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: AEN16023
LinkDB
Position
complement(1451485..1451958)
AA seq 157 aa
MQKIGIYPGTFDPVTNGHIDIIHRSSELFEKLIVAVAHSSAKNPMFSLDERLKMMQLATT
SFTNVECVAFEGLLANLAKEYHCKVLVRGLRVVSDFEYELQMGYANKSLNHELETLYFMP
TLQNAFISSSIVRSIIAHKGDASHLVPKEIHPFISKF
NT seq 474 nt   +upstreamnt  +downstreamnt
atgcaaaaaatcggcatttacccgggcacttttgatccggtcactaacgggcatatagac
atcatccaccgctctagcgaattgtttgaaaagctcattgtggctgtggcgcactcaagt
gctaaaaaccccatgtttagtttagatgaacgcttaaaaatgatgcaactggccactaca
agttttacaaatgtagaatgcgttgcgtttgaagggctattagccaacttggctaaagaa
taccattgtaaggtgttagttaggggcttaagggtggtgagcgattttgaatacgaattg
caaatgggctatgcgaacaaatccttaaaccacgaattagaaaccttgtatttcatgccc
actttacaaaacgctttcataagctcttctatcgtgcgatccattattgcgcataagggc
gatgcgagccatttagtgcctaaagaaattcacccttttatttcaaagttttaa

DBGET integrated database retrieval system