Helicobacter pylori Rif1: C695_02890 Help Entry C695_02890        CDS       T02317                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism her  Helicobacter pylori Rif1 Pathway her01100   Metabolic pathways her01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:her00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C695_02890 (acpP)    00074 Mycolic acid biosynthesis     C695_02890 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C695_02890 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N DUF7080 PP-binding_2 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  AFV43373 LinkDB All DBs Position complement(594045..594281) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAVQVTPEAEFVKDLGADSLDVVELIMALEEKFGVEIPDEQAE KIINVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggtg caagttacgccagaggcggaatttgtgaaggatttgggtgcagactctttagatgtcgtg gaattaatcatggcgttagaagaaaagtttggcgttgagattcctgatgagcaagcggaa aaaatcatcaatgtgggcgatgtggtgaagtatattgaggataataaactggcttaa

DBGET integrated database retrieval system