KEGG   Helicobacter pylori Rif1: C695_02995
Entry
C695_02995        CDS       T02317                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
her  Helicobacter pylori Rif1
Pathway
her00540  Lipopolysaccharide biosynthesis
her01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:her00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    C695_02995
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:her01005]
    C695_02995
Lipopolysaccharide biosynthesis proteins [BR:her01005]
 Lipid A
  C695_02995
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AFV43392
LinkDB
Position
complement(610912..612030)
AA seq 372 aa
MEPSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFMRNQTLVTQTPPYFTQLTIPKPNDA
LSVHASSLISLPNDNLLSAYFSGTKEGARDVKISANLFDSKTNRWSEAFIILTKEELSHY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIRFKFARKLSLSPF
LNLSHLIRNKPLSTTDGGFMLPLYHELATQYPLLLKFDQQNNPRELLRPNALNHQLQPSL
TPFKDCAIMAFRNHSFKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNEELYLIHN
PSDSSLRRKELWLSKLENSNSFKTLKVLDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaaccttcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaatcataatgaagcgccaaacccccccctatgcttttatgcgcaatcaaacc
cttgttactcaaacccccccctatttcacacaactcactatccctaaaccaaatgacgct
ttaagcgtgcatgcgagctctttaatcagcttgcctaacgacaatcttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagtgcaaatctttttgacagc
aaaactaatcgctggagcgaagccttcattattttaaccaaagaagagctttctcattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcgttttaagtttgcgcgaaaactctctttaagccctttt
ttaaacttaagccatttgataagaaataagcctttaagcaccactgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgaccaacaa
aataacccacgagagcttttaaggcctaatgccctaaaccaccagctccaaccaagccta
accccctttaaagattgcgctattatggcgtttagaaaccattcttttaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacgaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaggaactctggctttctaaattagaaaactccaac
tcttttaaaaccttaaaagttttagataaagcgaatgaagtgagttacccaagctatagc
cttaatcctcattttatagatattgtctatacttataaccgctctcatatcaaacacatc
cgtttcaatatggcttatttaaaatccctcctcaagtga

DBGET integrated database retrieval system