Helicobacter pylori SouthAfrica7: HPSA_02585 Help Entry HPSA_02585        CDS       T01921                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hes  Helicobacter pylori SouthAfrica7 Pathway hes01100   Metabolic pathways hes01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hes00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     HPSA_02585 (acpP)    00074 Mycolic acid biosynthesis     HPSA_02585 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     HPSA_02585 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L12_N ACP_SdgA_C PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  ADU84526 UniProt:  E8QVQ5 LinkDB All DBs Position complement(525867..526103) Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGVEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggca caagttacgccagaagcggaatttgtaaaagatttgggcgcggactctttagatgtcgtg gaattgatcatggcgttagaagaaaagtttggcgttgaaatccctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcctaa

DBGET integrated database retrieval system