KEGG   Helicobacter pylori SouthAfrica7: HPSA_02685
Entry
HPSA_02685        CDS       T01921                                 
Name
(GenBank) neuraminidase (sialidase)
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hes  Helicobacter pylori SouthAfrica7
Pathway
hes00540  Lipopolysaccharide biosynthesis
hes01100  Metabolic pathways
Module
hes_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hes00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPSA_02685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hes01005]
    HPSA_02685
Lipopolysaccharide biosynthesis proteins [BR:hes01005]
 Lipid A
  HPSA_02685
SSDB
Motif
Pfam: BNR_2
Other DBs
NCBI-ProteinID: ADU84546
UniProt: E8QVS5
LinkDB
Position
complement(543779..544777)
AA seq 332 aa
MLLKPPPYFTQLIIPKPHDALSVHASTLISLPNGNLLSAYFSGTKEGARDVKISANLFDG
KSNRWGEAFIILTKEKLSKNAHEYIKKLGNPLLFLHNDKILLFVVGVSMGGWATSKIYQF
ESALEPIDFKFVQKLSLNPFLNLSHLVRTKPLNTTDGGFVLPIYHELATQYPLLLKFDKH
HNPRELLRPNALNHQLQPSLTPFKDCAIMAFRNHSFKDHLMLETCKNPTTWQKVMPTNLK
NLDDSLNLLNLNGSLYLIHNPSDLSLRRKELLLSKLENINSFQTLKILDKANEVSYPSSS
LNPYFIDIVYTYNRSNIKHIRFNMAYLNSLLK
NT seq 999 nt   +upstreamnt  +downstreamnt
ttgttactgaaaccccccccctatttcacccagcttattatccctaaaccccatgacgct
ttaagcgtgcatgcaagcacgctaatcagcctacctaatggcaatctcttgagcgcttat
tttagcggcactaaagaaggggcaagagatgtgaagatcagcgctaatctttttgatggc
aaatccaatcgttggggtgaagctttcattattttaactaaagaaaagctttccaaaaac
gcgcatgaatatatcaaaaaattgggtaaccccttacttttcttgcataacgataagatt
ttgttgtttgtcgtgggggtgagcatgggcgggtgggcgacttctaaaatctatcaattt
gagagcgctttagagccgattgatttcaaatttgtgcaaaaactctctttaaaccctttt
ttaaacttgagccatttagtaaggactaaacccttaaacaccactgatggtgggtttgtg
ctgccgatctatcacgaattagccacgcaataccccttgttattgaaatttgacaaacac
cataaccctagagagcttttaaggccaaacgctttaaaccaccagctccagccaagcctg
accccctttaaagactgcgctatcatggcgtttagaaaccattcttttaaagatcacctc
atgctagaaacttgcaaaaaccccaccacttggcaaaaagtcatgcccacgaatttgaaa
aacttagacgattctttgaatttactcaatttgaatggatcgctatatctgatccataac
cctagcgatttgtccttacggcgtaaagaactcttgctttctaaattagaaaatataaac
tcgtttcaaaccttaaaaattttggataaagccaatgaagtgagttacccaagctctagc
cttaatccttattttatagacattgtctatacttataaccgctctaatatcaaacacatc
cgtttcaatatggcttatttaaattcccttctcaagtaa

DBGET integrated database retrieval system