Helicobacter enhydrae: BBW65_03965 Help Entry BBW65_03965       CDS       T05984                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism het  Helicobacter enhydrae Pathway het01100   Metabolic pathways het01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:het00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     BBW65_03965    00074 Mycolic acid biosynthesis     BBW65_03965   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     BBW65_03965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  ANV98006 UniProt:  A0A1B1U5H2 LinkDB All DBs Position 856589..856813 Genome browser AA seq 74 aa AA seqDB search MKKQEFLLALQDALQRDEALEENMKLNELEEWDSLAIVSLIALYDQLFAIQVTGNTLREC QSVSDLIALAKLQD NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaaaaaacaagaatttcttttagcattacaagatgctttgcaaagagatgaggcatta gaagagaatatgaaattgaatgaattagaagaatgggattctttggcaatcgtttcatta attgcactttatgatcagctttttgcaatccaagtaactggcaacaccctaagagaatgt cagtctgtttcagatttgattgcacttgcaaagcttcaagattag

DBGET integrated database retrieval system