KEGG   Helicobacter pylori Puno135: HPPN135_02860
Entry
HPPN135_02860     CDS       T01920                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
heu  Helicobacter pylori Puno135
Pathway
heu00540  Lipopolysaccharide biosynthesis
heu01100  Metabolic pathways
Module
heu_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:heu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPPN135_02860
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:heu01005]
    HPPN135_02860
Lipopolysaccharide biosynthesis proteins [BR:heu01005]
 Lipid A
  HPPN135_02860
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AEN18272
UniProt: G2M846
LinkDB
Position
complement(567823..568941)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLIIMKRQTPPYAFVHNQTLSTKSPPYFTQLTIPKPDDA
LSVHASALISLPNDNLLSAYFSGTKEGARDVKISANLFDNKINRWSEAFIILTKEELSHY
SHEYIKKLGNPLLFLHGDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVQKLSLSPF
LNLSHLIKNKPLNTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSL
TPFKDCAVMAFRNHSLKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaagcatgccgccttttttgtggggctttttatcgtt
ttatttttaattataatgaagcgccaaacccccccctatgcttttgtgcacaatcaaacc
ctttcaaccaaaagccccccctatttcacacagctcactatccctaaaccagatgacgct
ttaagcgtgcatgcgagtgctttaatcagtttgcctaacgataaccttttgagcgcttat
tttagcggcactaaagaaggggcaagggatgtgaaaatcagcgcgaatctttttgacaac
aagatcaatcgctggagtgaagccttcatcattttaaccaaagaagagctttctcattat
tcgcatgaatatatcaaaaaactaggtaaccccttgctttttttgcatggcgataaaatt
ttgttatttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccgattcattttaagtttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaaacaccactgatggcgggtttatg
ctaccgctctatcacgaattagccacccaataccccttgttgttgaaatttgacaaacac
aataacccaagagagcttttaaggcctaatgccctaaaccaccagctccagccaagccta
accccctttaaagactgtgctgtcatggcgtttagaaaccattctttaaaagatagcctc
atgctagaaacttgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatcactgcgtcgtaaagaactcttgctttctaaattagaaaactcaaat
tcttttaaaaccttaaaaattttagataaagcgaatgaagtgagttacccaagctatagt
cttaatcctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system