KEGG   Helicobacter pylori F57: HPF57_0605
Entry
HPF57_0605        CDS       T01912                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hex  Helicobacter pylori F57
Pathway
hex00540  Lipopolysaccharide biosynthesis
hex01100  Metabolic pathways
Module
hex_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hex00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    HPF57_0605
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hex01005]
    HPF57_0605
Lipopolysaccharide biosynthesis proteins [BR:hex01005]
 Lipid A
  HPF57_0605
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: BAJ59679
UniProt: E6NRB3
LinkDB
Position
complement(625172..626290)
AA seq 372 aa
MEHSRNRLKHAAFFVGLFIVLFLMIMKRQTPSYAFLHNQTLSTKSPPYFTQLIIPKPDDA
LSVHASALISLPNDNLLSTYFSGTKEGARDVKISANLFDSKINRWSKAFVILTKEELSHY
SHEYIKKLGNPLLFLHDDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVQKLSLSPF
LNLSHLIKNKPLSTTDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNNQLQPSL
TPFKDCAIMAFRNHSLKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHN
PSDSSLRRKELLLSKLENSNSFKTLKILDKANEVSYPSYSLNSHFIDIVYTYNRSHIKHI
RFNMAYLKSLLK
NT seq 1119 nt   +upstreamnt  +downstreamnt
ttggaacattcaagaaatcgcctaaaacatgccgccttttttgtggggctttttatcgtt
ttatttttaatgataatgaagcgccaaaccccctcctatgcttttttgcataatcaaacc
ctttcaaccaaaagccccccctatttcactcagctcattatccctaaaccagatgacgct
ttaagcgtgcatgcgagcgctttaatcagcttgcctaacgataaccttttgagcacttat
tttagcggcactaaagaaggggcaagagatgtgaaaatcagcgcgaatctttttgacagc
aagatcaatcgctggagcaaagccttcgttattttaaccaaagaagagctttctcattat
tcgcatgaatacatcaaaaaactaggtaaccccttgctttttttgcatgacgataaaatt
ttgttgtttgtcgtaggggtgagcatgggcgggtgggccacttctaaaatctatcaactt
gaaagcgctttagagccaattcattttaaatttgtgcaaaaactctctttaagccctttt
ttaaacttaagccatttgataaaaaataagcctttaagcaccactgatggcgggtttatg
ctaccactctatcacgaattagccacccaataccccttattgttgaaatttgacaaacac
aataacccaagagaacttttaaggcctaatgccctaaacaaccagctccagccaagccta
accccctttaaagactgcgccatcatggcgtttagaaaccattctttaaaagatagcctc
atgctagaaacctgtaaaacccccaccgcttggcaaaaacccatgcttacgaatttgaaa
aacttgaatgacgctttgaatttgatcaatttaaacaaagaattgtatttgatccacaac
cctagcgattcatctttgcgtcgtaaagaacttttgctttctaaattagaaaactcaaac
tcttttaaaaccttaaaaattttagataaagcaaatgaagtgagttacccaagctatagt
cttaattctcattttatagatattgtctatacctacaaccgctctcatatcaaacacatc
cgttttaatatggcctatttaaaatcccttctcaagtga

DBGET integrated database retrieval system