KEGG   Helicobacter pylori XZ274: MWE_0937
Entry
MWE_0937          CDS       T02130                                 
Name
(GenBank) hypothetical protein
  KO
K23083  3-deoxy-D-manno-octulosonic acid-hydrolase
Organism
hey  Helicobacter pylori XZ274
Pathway
hey00540  Lipopolysaccharide biosynthesis
hey01100  Metabolic pathways
Module
hey_M00867  KDO2-lipid A modification pathway
Brite
KEGG Orthology (KO) [BR:hey00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    MWE_0937
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:hey01005]
    MWE_0937
Lipopolysaccharide biosynthesis proteins [BR:hey01005]
 Lipid A
  MWE_0937
SSDB
Motif
Pfam: BNR_2 DUF3741
Other DBs
NCBI-ProteinID: AFJ81746
UniProt: I2DG80
LinkDB
Position
855497..856573
AA seq 358 aa
MGLFIVLFLMIMKRQTPTYAFVRNQTLSTKNPPYFTQLTIPKPNDALSVHANALISLPND
NLLSAYFSGTKEGARDVKISANLFDSKINRWSEAFIILTKEELSYYSHEYIKKLGNPLLF
LHDDKILLFVVGVSMGGWATSKIYQLESALEPIHFKFVQKLSLNPFLNLSHLVRNKPLNT
TDGGFMLPLYHELATQYPLLLKFDKHNNPRELLRPNALNHQLQPSLTPFKDCAIMAFRNH
SLKDSLMLETCKTPTAWQKPMLTNLKNLNDALNLINLNKELYLIHNPSDSSLRRKELLLS
KLENSNSFKTLKILDKANEVSYPSYSLNPHFIDIVYTYNRSHIKHIRFNMAYLKSLLK
NT seq 1077 nt   +upstreamnt  +downstreamnt
gtggggctttttatcgttttatttttaatgataatgaagcgccaaacccccacctatgct
tttgtgcgcaatcaaaccctttcaaccaaaaaccccccctatttcacacaactcactatc
cctaaaccaaatgacgctttaagcgtgcatgcgaacgctttaatcagcttgcctaacgat
aaccttttgagcgcttattttagcggcactaaagaaggggcaagggatgtgaaaatcagc
gcgaatctttttgacagcaagatcaatcgctggagcgaagccttcattattttaaccaaa
gaagagctttcttattattcgcatgaatatatcaaaaaactaggtaaccccttgcttttt
ttgcatgacgataaaattttgttgtttgtcgtaggggtgagcatgggcgggtgggccact
tctaaaatctaccaacttgaaagcgctttagagccgattcattttaaatttgtgcaaaaa
ctctctttaaacccttttttaaacttaagccatttggtaaggaataagcctttaaacacc
actgatggcgggtttatgctaccgctttatcacgaattagccacccaataccccttattg
ttgaaatttgacaaacacaataacccaagagagcttttaaggcctaatgccctaaaccac
cagctccagccaagcctaaccccctttaaagactgcgccatcatggcgtttagaaaccat
tctttaaaagatagtctcatgctagaaacctgtaaaacccccaccgcttggcaaaaaccc
atgcttacgaatttgaaaaacttgaatgacgctttgaatttgatcaatttaaacaaagaa
ttgtatttgatccacaaccctagcgattcatctttgcgtcgtaaagaactcttgctttct
aaattagaaaactcaaactcttttaaaaccttaaaaattttagataaagcaaatgaagtg
agttacccaagctatagtcttaatcctcattttatagatattgtttatacctacaaccgc
tctcatatcaaacacatccgttttaatatggcttatttaaaatcccttctcaagtga

DBGET integrated database retrieval system