Helicobacter pylori XZ274: MWE_0959 Help Entry MWE_0959          CDS       T02130                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism hey  Helicobacter pylori XZ274 Pathway hey01100   Metabolic pathways hey01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:hey00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MWE_0959 (acpP)    00074 Mycolic acid biosynthesis     MWE_0959 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MWE_0959 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Ribosomal_L12_N ACP_SdgA_C PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  AFJ81765 LinkDB All DBs Position 873160..873396 Genome browser AA seq 78 aa AA seqDB search MALFEDIQAVIAEQLNVDAAQVTPEAEFVKDLGADSLDVVELIMALEEKFGIEIPDEQAE KIVNVGDVVKYIEDNKLA NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atggctttatttgaagatattcaggcagttattgctgagcagttgaatgtggatgcggcg caagttacgccagaggcggaatttgtgaaggatttgggtgcggactctttagatgttgtg gaattaatcatggcgttagaagaaaagtttggcattgagattcctgatgagcaagcggaa aaaatcgtcaatgtgggcgatgtggtgaagtatattgaggataataaactagcttaa

DBGET integrated database retrieval system